null

Recombinant Human Vesicle-associated membrane protein-associated protein B/C (VAPB), partial (Active) | CSB-AP005491HU

(No reviews yet) Write a Review
SKU:
CSB-AP005491HU
Availability:
5 to 10 Working Days
  • Recombinant Human Vesicle-associated membrane protein-associated protein B/C (VAPB) ,partial (Active)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$262.80 - $496.80
Frequently bought together:

Description

Recombinant Human Vesicle-associated membrane protein-associated protein B/C (VAPB) ,partial (Active) | CSB-AP005491HU | Cusabio

Protein Description: Partial

Alternative Name (s) : Vesicle-associated membrane protein-associated protein B/C;VAMP-B/VAMP-C;VAMP-associated protein B/C;VAP-B/VAP-C

Gene Names: VAPB

Research Areas: Signal Transduction

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: C-terminal 6xHis-tagged

Expression Region: 2-132aa

Sequence Info: AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKP

Biological Activity: The ED50 as determined by its ability to bind Human EphB2 in functional ELISA is less than 20 ug/ml.

MW: 16 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: vesicle-associated membrane protein-associated protein B/C (VAPB) is presents in mitochondria-associated membranes that are endoplasmic reticulum membrane regions closely apposed to the outer mitochondrial membrane. It can form homodimer, and heterodimer with VAPA. It also interacts with VAMP1, VAMP2, HCV NS5A, NS5B, ZFYVE27 and RMDN3. VAPB participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. It is involved in cellular calcium homeostasis regulation.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. Involved in cellular calcium homeostasis regulation.

Involvement in disease: Amyotrophic lateral sclerosis 8 (ALS8) ; Spinal muscular atrophy, proximal, adult, autosomal dominant (SMAPAD)

Subcellular Location: Endoplasmic reticulum membrane, Single-pass type IV membrane protein

Protein Families: VAMP-associated protein (VAP) (TC 9.B.17) family

Tissue Specificity: Ubiquitous. Isoform 1 predominates.

Paythway: Cholesterolmetabolism

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O95292

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose