Cusabio Human Recombinants
Recombinant Human Vacuolar protein sorting-associated protein 13A (VPS13A), partial | CSB-EP850425HU
- SKU:
- CSB-EP850425HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Vacuolar protein sorting-associated protein 13A (VPS13A), partial | CSB-EP850425HU | Cusabio
Alternative Name(s): Chorea-acanthocytosis protein Chorein
Gene Names: VPS13A
Research Areas: Neuroscience
Organism: Homo sapiens (Human)
AA Sequence: RPPRFFNEDGVIRPYRLRDGTGNQMLQVMENGRFAKYKYFTHVMINKTDMLMITRRGVLFVTKGTFGQLTCEWQYSFDEFTKEPFIVHGRRLRIEAKERVKSVF
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 3037-3140aa
Sequence Info: Partial
MW: 28.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: May play a role in the control of protein cycling through the trans-Golgi network to early and late endosomes, lysosomes and plasma membrane.
Reference: "Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.DNA Res. 6:63-70(1999)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: May play a role in the control of protein cycling through the trans-Golgi network to early and late endosomes, lysosomes and plasma membrane.
Involvement in disease: Choreoacanthocytosis (CHAC)
Subcellular Location:
Protein Families: VPS13 family
Tissue Specificity: Widely expressed. Higher expression is found in brain, heart, skeletal muscle and kidney.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q96RL7
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM