Cusabio Human Recombinants
Recombinant Human Urokinase-type plasminogen activator (PLAU), partial | CSB-RP143194h(A4)
- SKU:
- CSB-RP143194h(A4)
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Urokinase-type plasminogen activator (PLAU), partial | CSB-RP143194h(A4) | Cusabio
Alternative Name(s): ATF; ATF uPA; BDPLT5; Plasminogen activator; Plasminogen activator urinary; Plasminogen activator urokinase; PLAU; QPD; u PA; U plasminogen activator; u-PA; U-plasminogen activator; uPA; URK; UROK_HUMAN; Urokinase plasminogen activator; Urokinase type plasminogen activator; Urokinase type plasminogen activator precursor; Urokinase-type plasminogen activator chain B
Gene Names: PLAU
Research Areas: Cardiovascular
Organism: Homo sapiens (Human)
AA Sequence: SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTL
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 21-173aa
Sequence Info: Partial
MW: 21.3 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
Reference: "Complete sequencing and characterization of 21,243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
Involvement in disease: Quebec platelet disorder (QPD)
Subcellular Location: Secreted
Protein Families: Peptidase S1 family
Tissue Specificity: Expressed in the prostate gland and prostate cancers.
Paythway: NF-kappaBsignalingpathway
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P00749
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM