null

Recombinant Human Uncharacterized protein KIAA1377 (KIAA1377), partial | CSB-YP868394HU

(No reviews yet) Write a Review
SKU:
CSB-YP868394HU
Availability:
25 - 35 Working Days
  • Recombinant Human Uncharacterized protein KIAA1377 (KIAA1377), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€262.00 - €943.00
Frequently bought together:

Description

Recombinant Human Uncharacterized protein KIAA1377 (KIAA1377), partial | CSB-YP868394HU | Cusabio

Alternative Name(s): CEP126; KIAA1377; Centrosomal protein of 126 kDa

Gene Names: KIAA1377

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: HKKMKYNIHERNGVRFLKSILKKESKYEHGYLKALIINQSFKFGNQKAAAIRDSIELTKEKGAEIPKTIKKLRWFDETSNIENNAENSHSLKNKTGTTQQHSQQFHIQSGAG

Source: Yeast

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 559-670aa

Sequence Info: Partial

MW: 28.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Participates in cytokinesis . Necessary for microtubules and mitotic spindle organization . Involved in primary cilium formation .

Reference: Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Participates in cytokinesis

Involvement in disease:

Subcellular Location: Midbody, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Cytoplasm, cytoskeleton, cilium basal body

Protein Families:

Tissue Specificity: Expressed in brain, lung, skeletal muscle, kidney, pancreas, testis and ovary.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9P2H0

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose