Recombinant Human Uncharacterized protein C4orf3 (C4orf3), partial | CSB-EP823892HU

Recombinant Human Uncharacterized protein C4orf3 (C4orf3), partial | CSB-EP823892HU | Cusabio

Alternative Name(s): Hepatitis C virus F protein-transactivated protein 1 ;HCV F-transactivated protein 1

Gene Names: C4orf3

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSY

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-44aa

Sequence Info: Partial

MW: 20.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Screening and cloning target genes transactivated by hepatitis C virus F protein using suppression subtractive hybridization technique.Guo J., Cheng J., Ji D., Zhao L.F., Gao X.S., Liu Y., Wu S.H.Zhonghua Gan Zang Bing Za Zhi 13:660-663(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Membrane, Single-pass membrane protein

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8WVX3

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A