Recombinant Human Uncharacterized protein C11orf73 (C11orf73) | CSB-EP706632HU

(No reviews yet) Write a Review
SKU:
CSB-EP706632HU
Availability:
13 - 23 Working Days
  • Recombinant Human Uncharacterized protein C11orf73 (C11orf73)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Uncharacterized protein C11orf73 (C11orf73) | CSB-EP706632HU | Cusabio

Alternative Name(s): C11orf73; Chromosome 11 open reading frame 73; CK073_HUMAN; FLJ43020; Hikeshi; HSPC138; HSPC179; L7RN6; Lethal Chr 7 Rinchik 6; OPI10; Protein Hikeshi; Uncharacterized protein C11orf73

Gene Names: C11orf73

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-197aa

Sequence Info: Full Length

MW: 37.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Acts as a specific nuclear import carrier for HSP70 proteins following heat-shock stress: acts by mediating the nucleoporin-dependent translocation of ATP-bound HSP70 proteins into the nucleus. HSP70 proteins import is required to protect cells from heat shock damages. Does not translocate ADP-bound HSP70 proteins into the nucleus.

Reference: Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Acts as a specific nuclear import carrier for HSP70 proteins following heat-shock stress

Involvement in disease: Leukodystrophy, hypomyelinating, 13 (HLD13)

Subcellular Location: Cytoplasm, cytosol, Nucleus

Protein Families: OPI10 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q53FT3

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose