Recombinant Human UL16-binding protein 2 (ULBP2), partial (Active) | CSB-AP005521HU

Recombinant Human UL16-binding protein 2 (ULBP2) ,partial (Active) | CSB-AP005521HU | Cusabio

Protein Description: Partial

Alternative Name (s) : NKG2D Ligand 2; N2DL-2; NKG2DL2; ALCAN-Alpha; Retinoic Acid Early Transcript 1H; UL16-Binding Protein 2; ULBP2; N2DL2; RAET1H

Gene Names: ULBP2

Research Areas: Immunology

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal Fc-tagged

Expression Region: 26-217aa

Sequence Info: GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS

Biological Activity: The ED50 as determined by its ability to bind Human ULBP-2 in functional ELISA is less than 30 ug/ml.

MW: 51.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: NKG2D Ligand 2 (N2DL2) is a member of a family of cell-surface proteins. N2DL2 function as ligands for human cytomegalovirus glycoprotein UL16. N2DL2 is anchored to the membrane via a GPI-linkage. N2DL2 is bind to human NKG2D, an activating receptor expressed on NK cells, NKT cells, T cells. Engagement of NKG2D results in the activation of cytolytic activity and cytokine production by these effects cells. The ULBPs are expressed on some tumor cells and have been implicated in tumor surveillance.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor, Endoplasmic reticulum, Secreted

Protein Families: MHC class I family

Tissue Specificity: Expressed in various types of cancer cell lines and in the fetus, but not in normal tissues.

Paythway: Naturalkillercellmediatedcytotoxicity

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9BZM5

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM