Recombinant Human Ubiquitin-conjugating enzyme E2 variant 2 (UBE2V2) | CSB-EP025484HU

(No reviews yet) Write a Review
SKU:
CSB-EP025484HU
Availability:
3 - 7 Working Days
  • Recombinant Human Ubiquitin-conjugating enzyme E2 variant 2 (UBE2V2)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Ubiquitin-conjugating enzyme E2 variant 2 (UBE2V2) | CSB-EP025484HU | Cusabio

Alternative Name(s): DDVit 1Enterocyte differentiation-associated factor 1 ;EDAF-1Enterocyte differentiation-promoting factor 1 ;EDPF-1MMS2 homologVitamin D3-inducible protein

Gene Names: UBE2V2

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: AVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-145aa

Sequence Info: Full Length of Mature Protein

MW: 32.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.

Reference: "The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines."David Y., Ziv T., Admon A., Navon A.J. Biol. Chem. 285:8595-8604(2010)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.

Involvement in disease:

Subcellular Location:

Protein Families: Ubiquitin-conjugating enzyme family

Tissue Specificity: Detected in placenta, colon, liver and skin. Detected at very low levels in most tissues.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q15819

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose