Recombinant Human Ubiquitin-conjugating enzyme E2 D4 (UBE2D4) | CSB-EP896498HU

Recombinant Human Ubiquitin-conjugating enzyme E2 D4 (UBE2D4) | CSB-EP896498HU | Cusabio

Alternative Name(s): E2 ubiquitin-conjugating enzyme D4 HBUCE1 Ubiquitin carrier protein D4 Ubiquitin-protein ligase D4

Gene Names: UBE2D4

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-147aa

Sequence Info: Full Length

MW: 43.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11' and 'Lys-48'-linked polyubiquitination.

Reference: "Molecular cloning and screening of two ubiquitin conjugation enzymes." Li G., Jin J., Hu S., Li W., Yuan J., Qiang B. Submitted (JAN-1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11' and 'Lys-48'-linked polyubiquitination.

Involvement in disease:

Subcellular Location:

Protein Families: Ubiquitin-conjugating enzyme family

Tissue Specificity:

Paythway: Proteinprocessinginendoplasmicreticulum

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9Y2X8

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A