Recombinant Human Tyrosine--tRNA ligase, Cytoplasmic domain (YARS1) | CSB-EP026245HU

Recombinant Human Tyrosine--tRNA ligase, Cytoplasmic domain (YARS1) | CSB-EP026245HU | Cusabio

Alternative Name(s): Tyrosyl-tRNA synthetase ;TyrRS

Gene Names: YARS1

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: GDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPMAKGPAKNSEPEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 2-528aa

Sequence Info: Full Length of Mature Protein

MW: 86 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of tRNA(Tyr).

Reference: Evidence that two present-day components needed for the genetic code appeared after nucleated cells separated from eubacteria.Ribas de Pouplana L., Frugier M., Quinn C.L., Schimmel P.Proc. Natl. Acad. Sci. U.S.A. 93:166-170(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction

Involvement in disease: Charcot-Marie-Tooth disease, dominant, intermediate type, C (CMTDIC)

Subcellular Location: Cytoplasm

Protein Families: Class-I aminoacyl-tRNA synthetase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P54577

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM