Recombinant Human Type-2 angiotensin II receptor (AGTR2), partial | CSB-EP001466HU

Recombinant Human Type-2 angiotensin II receptor (AGTR2), partial | CSB-EP001466HU | Cusabio

Alternative Name(s): Angiotensin II type-2 receptor Short name:AT2

Gene Names: AGTR2

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-45aa

Sequence Info: Partial

MW: 20.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Receptor for angiotensin II. Cooperates with MTUS1 to inhibit ERK2 activation and cell proliferation.

Reference: "Assignment of the human angiotensin II type 2 receptor gene (AGTR2) to chromosome Xq22-q23 by fluorescence in situ hybridization." Chassagne C., Beatty B.G., Meloche S.Genomics 25:601-603(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Receptor for angiotensin II. Cooperates with MTUS1 to inhibit ERK2 activation and cell proliferation.

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein

Protein Families: G-protein coupled receptor 1 family

Tissue Specificity: In adult, highly expressed in myometrium with lower levels in adrenal gland and fallopian tube. Expressed in the cerebellum. Very highly expressed in fetal kidney and intestine.

Paythway: Renin-angiotensinsystem

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P50052

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM