Recombinant Human Type-1 angiotensin II receptor (AGTR1), partial | CSB-YP001465HU

(No reviews yet) Write a Review
SKU:
CSB-YP001465HU
Availability:
25 - 35 Working Days
  • Recombinant Human Type-1 angiotensin II receptor (AGTR1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€339.00 - €1,345.00

Description

Recombinant Human Type-1 angiotensin II receptor (AGTR1), partial | CSB-YP001465HU | Cusabio

Alternative Name(s): AT1ARAT1BRAngiotensin II type-1 receptor ;AT1

Gene Names: AGTR1

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: LNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 297-359aa

Sequence Info: Partial

MW: 9.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger syst.

Reference: Cloning, expression, and characterization of a gene encoding the human angiotensin II type 1A receptor.Mauzy C.A., Hwang O., Egloff A.M., Wu L.H., Chung F.-Z.Biochem. Biophys. Res. Commun. 186:277-284(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.

Involvement in disease: Renal tubular dysgenesis (RTD)

Subcellular Location: Cell membrane, Multi-pass membrane protein

Protein Families: G-protein coupled receptor 1 family

Tissue Specificity: Liver, lung, adrenal and adrenocortical adenomas.

Paythway: Calciumsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P30556

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose