Recombinant Human Tumor necrosis factor receptor superfamily member 1B (TNFRSF1B), partial (Active) | CSB-AP004891HU

(No reviews yet) Write a Review
SKU:
CSB-AP004891HU
Availability:
5 to 10 Working Days
  • Recombinant Human Tumor necrosis factor receptor superfamily member 1B (TNFRSF1B) ,partial (Active)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$278.40 - $595.20

Description

Recombinant Human Tumor necrosis factor receptor superfamily member 1B (TNFRSF1B) ,partial (Active) | CSB-AP004891HU | Cusabio

Protein Description: Extracellular Domain

Alternative Name (s) : Tumor necrosis factor receptor superfamily member 1B; Tumor necrosis factor receptor 2; Tumor necrosis factor receptor type II; p75; p80 TNF-alpha receptor; TBP-2; TBPII; TNFRSF1B; TNFBR; TNFR2

Gene Names: TNFRSF1B

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal 6xHis-tagged

Expression Region: 23-257aa

Sequence Info: LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD

Biological Activity: The ED50 as determined by its ability to inhibit TNFa-mediated cytotoxicity using L‑929 mouse fibroblast cells treated with TNFa is less than 0.6 µg/mL.

MW: 26.2 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Tumor necrosis factor receptor superfamily member 1B is a 461 amino acids protein that belongs to the TNFR (tumor necrosis factor receptor) superfamily characterized by cysteine-rich extracellular domains. It contains 4 TNFR-Cys repeats. TNFRII is expressed in fetal brain. TNFRII is strongly expressed at the cartilage-pannus junction, and plays a major role in a subset of families with multiple cases of rheumatoid arthritis (RA) . This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.

Involvement in disease:

Subcellular Location: Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted, SUBCELLULAR LOCATION: Tumor necrosis factor-binding protein 2: Secreted

Protein Families:

Tissue Specificity:

Paythway: TNFsignalingpathway

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P20333

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose