Recombinant Human Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A), partial | CSB-YP023977HU1

(No reviews yet) Write a Review
SKU:
CSB-YP023977HU1
Availability:
25 - 35 Working Days
€262.00 - €943.00

Description

Recombinant Human Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A), partial | CSB-YP023977HU1 | Cusabio

Alternative Name(s): Tumor necrosis factor receptor 1 (TNF-R1) (Tumor necrosis factor receptor type I) (TNF-RI) (TNFR-I) (p55) (p60) (CD_antigen: CD120a) (TNFAR) (TNFR1)

Gene Names: TNFRSF1A

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT

Source: Yeast

Tag Info: C-terminal 6xHis-tagged

Expression Region: 22-211aa

Sequence Info: Partial

MW: 22.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.

Reference: "Cloning of human tumor necrosis factor (TNF) receptor cDNA and expression of recombinant soluble TNF-binding protein." Gray P.W., Barrett K., Chantry D., Turner M., Feldman M. Proc. Natl. Acad. Sci. U.S.A. 87:7380-7384(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P19438

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose