Recombinant Human Tumor necrosis factor receptor superfamily member 11A (TNFRSF11A), partial | CSB-EP896933HU

(No reviews yet) Write a Review
SKU:
CSB-EP896933HU
Availability:
3 - 7 Working Days
  • Recombinant Human Tumor necrosis factor receptor superfamily member 11A (TNFRSF11A), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $446.40

Description

Recombinant Human Tumor necrosis factor receptor superfamily member 11A (TNFRSF11A), partial | CSB-EP896933HU | Cusabio

Alternative Name(s): Osteoclast differentiation factor receptor ;ODFRReceptor activator of NF-KB; CD265

Gene Names: TNFRSF11A

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: LQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 28-202aa

Sequence Info: Partial

MW: 23.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Receptor for TNFSF11/RANKL/TRANCE/OPGL; essential for RANKL-mediated osteoclastogenesis. Involved in the regulation of interactions between T-cells and dendritic cells.

Reference: A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Receptor for TNFSF11/RANKL/TRANCE/OPGL; essential for RANKL-mediated osteoclastogenesis. Involved in the regulation of interactions between T-cells and dendritic cells.

Involvement in disease: Familial expansile osteolysis (FEO); Paget disease of bone 2, early-onset (PDB2); Osteopetrosis, autosomal recessive 7 (OPTB7)

Subcellular Location: Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform RANK-e5a: Cell membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity: Ubiquitous expression with high levels in skeletal muscle, thymus, liver, colon, small intestine and adrenal gland.

Paythway: NF-kappaBsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9Y6Q6

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose