Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9), partial (Active) | CSB-MP023997HU1

(No reviews yet) Write a Review
SKU:
CSB-MP023997HU1
Availability:
3 to 7 Working Days
  • Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9) ,partial (Active)
  • Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9) ,partial (Active) Activity
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$219.60 - $351.60

Description

Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9) ,partial (Active) | CSB-MP023997HU1 | Cusabio

Protein Description: Partial

Alternative Name (s) : (4-1BB ligand) (4-1BBL)

Gene Names: TNFSF9

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: N-terminal hFc-Myc-tagged

Expression Region: 71-254aa

Sequence Info: REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized TNFSF9 at 2 μg/mL can bind TNFRSF9(CSB-MP023984HU1), the EC50 is 2.671-3.702 ng/mL.

MW: 48.0 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance: Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD) . May play a role in cognate interactions between T-cells and B-cells/macrophages.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P41273

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose