Recombinant Human Tumor necrosis factor ligand superfamily member 9 protein (TNFSF9), partial | CSB-RP080474h

(No reviews yet) Write a Review
SKU:
CSB-RP080474h
Availability:
13 - 23 Working Days
  • Recombinant Human Tumor necrosis factor ligand superfamily member 9 protein (TNFSF9), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Tumor necrosis factor ligand superfamily member 9 protein (TNFSF9), partial | CSB-RP080474h | Cusabio

Alternative Name(s): 4-1BB ligand receptorCDw137T-cell antigen 4-1BB homologT-cell antigen ILA; CD137

Gene Names: TNFSF9

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: PWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 52-254aa

Sequence Info: Partial

MW: 25.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.

Reference: Molecular and biological characterization of human 4-1BB and its ligand.Alderson M.R., Smith C.A., Tough T.W., Davis-Smith T., Armitage R.J., Falk B., Roux E., Baker E., Sutherland G.R., Din W.S., Goodwin R.G.Eur. J. Immunol. 24:2219-2227(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type II membrane protein

Protein Families: Tumor necrosis factor family

Tissue Specificity: Expressed in brain, placenta, lung, skeletal muscle and kidney.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P41273

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose