Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active) | CSB-MP023996HU1

(No reviews yet) Write a Review
SKU:
CSB-MP023996HU1
Availability:
3 to 7 Working Days
  • Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8) ,partial (Active)
  • Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8) ,partial (Active) Activity
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€209.00 - €339.00

Description

Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8) ,partial (Active) | CSB-MP023996HU1 | Cusabio

Protein Description: Partial

Alternative Name (s) :

Gene Names: TNFSF8

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: N-terminal 6xHis-tagged

Expression Region: 63-234aa

Sequence Info: QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized CD30(CSB-MP023983HU1h6) at 5 μg/ml can bind human CD30L, the EC50 is 9.531-12.49 ng/ml.

MW: 21.8

Purity: Greater than 75% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance:

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P32971

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose