Recombinant Human Tumor necrosis factor ligand superfamily member 18 (TNFSF18), partial (Active) | CSB-MP891791HU

Recombinant Human Tumor necrosis factor ligand superfamily member 18 (TNFSF18) ,partial (Active) | CSB-MP891791HU | Cusabio

Protein Description: Partial

Alternative Name (s) :

Gene Names: TNFSF18

Research Areas: Immunology

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: N-terminal hFc-Flag-tagged

Expression Region: 72-199aa

Sequence Info: QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS

Biological Activity: ①Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18 (CSB-MP891791HU) , the EC50 is 2.565 to 2.940 ng/ml.②Human TNFRSF18 protein hFc tag (CSB-MP896537HU) captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag (CSB-MP891791HU) with an affinity constant of 38.5 nM as detected by LSPR Assay.

MW: 42.8

Purity: Greater than 94% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance:

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9UNG2

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A