Recombinant Human Tumor necrosis factor ligand superfamily member 14 (TNFSF14), partial (Active) | CSB-MP023991HUj2

Recombinant Human Tumor necrosis factor ligand superfamily member 14 (TNFSF14) ,partial (Active) | CSB-MP023991HUj2 | Cusabio

Protein Description: Partial

Alternative Name (s) : (Herpes virus entry mediator ligand) (HVEM-L) (Herpesvirus entry mediator ligand) (CD258) (HVEML) (LIGHT) (UNQ391) (PRO726)

Gene Names: TNFSF14

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: N-terminal hFC-Myc-tagged

Expression Region: 74-240aa

Sequence Info: DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV

Biological Activity: ①Measured by its binding ability in a functional ELISA. Immobilized TNFRSF14 (CSB-MP842173HU) at 5 μg/ml can bind TNFSF14, the EC50 is 45.44-53.29 ng/ml.

MW: 46.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance: Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Acts as a ligand for TNFRSF14/HVEM (PubMed:9462508, PubMed:10754304) . Upon binding to TNFRSF14/HVEM, delivers costimulatory signals to T cells, leading to T cell proliferation and IFNG production (PubMed:10754304) .

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O43557

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A