Recombinant Human Tubulin-specific chaperone cofactor E-like protein (TBCEL) | CSB-EP722183HU

Recombinant Human Tubulin-specific chaperone cofactor E-like protein (TBCEL) | CSB-EP722183HU | Cusabio

Alternative Name(s): Leucine-rich repeat-containing protein 35

Gene Names: TBCEL

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIYVESKTK

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-424aa

Sequence Info: Full Length

MW: 64.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Acts as a regulator of tubulin stability.

Reference: Identification of a novel tubulin-destabilizing protein related to the chaperone cofactor E.Bartolini F., Tian G., Piehl M., Cassimeris L., Lewis S.A., Cowan N.J.J. Cell Sci. 118:1197-1207(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Acts as a regulator of tubulin stability.

Involvement in disease:

Subcellular Location: Cytoplasm, cytoskeleton

Protein Families:

Tissue Specificity: Abundantly expressed in testis, but is also present in several tissues at a much lower level.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q5QJ74

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM