Recombinant Human Tubulin polymerization-promoting protein (TPPP) | CSB-EP024115HU

(No reviews yet) Write a Review
SKU:
CSB-EP024115HU
Availability:
13 - 23 Working Days
  • Recombinant Human Tubulin polymerization-promoting protein (TPPP)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Tubulin polymerization-promoting protein (TPPP) | CSB-EP024115HU | Cusabio

Alternative Name(s): 25KDA brain-specific protein TPPP/p25 p24 p25-alpha

Gene Names: TPPP

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-219aa

Sequence Info: Full Length

MW: 50.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May play a role in the polymerization of tubulin into microtubules, microtubule bundling and the stabilization of existing microtubules, thus maintaining the integrity of the microtubule network. May play a role in mitotic spindle assembly and nuclear envelope breakdown.

Reference: "p25alpha Stimulates alpha-synuclein aggregation and is co-localized with aggregated alpha-synuclein in alpha-synucleinopathies." Lindersson E., Lundvig D., Petersen C., Madsen P., Nyengaard J.R., Hoejrup P., Moos T., Otzen D., Gai W.-P., Blumbergs P.C., Jensen P.H. J. Biol. Chem. 280:5703-5715(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May play a role in the polymerization of tubulin into microtubules, microtubule bundling and the stabilization of existing microtubules, thus maintaining the integrity of the microtubule network. May play a role in mitotic spindle assembly and nuclear envelope breakdown.

Involvement in disease:

Subcellular Location: Cytoplasm, Cytoplasm, cytoskeleton, Nucleus

Protein Families: TPPP family

Tissue Specificity: Widely expressed.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O94811

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose