Recombinant Human Tubulin beta-2A chain (TUBB2A) | CSB-YP025320HU

Recombinant Human Tubulin beta-2A chain (TUBB2A) | CSB-YP025320HU | Cusabio

Alternative Name(s): Tubulin beta class IIa

Gene Names: TUBB2A

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-445aa

Sequence Info: Full Length

MW: 51.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain .

Reference: De novo mutations in the beta-tubulin gene TUBB2A cause simplified gyral patterning and infantile-onset epilepsy.Cushion T.D., Paciorkowski A.R., Pilz D.T., Mullins J.G., Seltzer L.E., Marion R.W., Tuttle E., Ghoneim D., Christian S.L., Chung S.K., Rees M.I., Dobyns W.B.Am. J. Hum. Genet. 94:634-641(2014)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain (By similarity).

Involvement in disease: Cortical dysplasia, complex, with other brain malformations 5 (CDCBM5)

Subcellular Location: Cytoplasm, cytoskeleton

Protein Families: Tubulin family

Tissue Specificity: High expression in brain, where it represents 30% of all beta-tubulins.

Paythway: Gapjunction

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q13885

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM