Recombinant Human Trypsin-3 (PRSS3), partial | CSB-EP330412HU1

(No reviews yet) Write a Review
SKU:
CSB-EP330412HU1
Availability:
3 - 7 Working Days
  • Recombinant Human Trypsin-3 (PRSS3), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Trypsin-3 (PRSS3), partial | CSB-EP330412HU1 | Cusabio

Alternative Name(s): Brain trypsinogen;Mesotrypsinogen;Serine protease 3Serine protease 4Trypsin IIITrypsin IV

Gene Names: PRSS3

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 81-303aa

Sequence Info: Partial

MW: 28.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Digestive protease specialized for the degradation of trypsin inhibitors. In the ileum, may be involved in defensin processing, including DEFA5.

Reference: Cloning of the cDNA encoding human brain trypsinogen and characterization of its product.Wiegand U., Corbach S., Minn A., Kang J., Mueller-Hill B.Gene 136:167-175(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Digestive protease specialized for the degradation of trypsin inhibitors. In the ileum, may be involved in defensin processing, including DEFA5.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Peptidase S1 family

Tissue Specificity: Expressed in pancreas and brain. Also expressed in Paneth cells, at the base of small intestinal crypts.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P35030

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose