Recombinant Human Tricarboxylate transport protein (SLC20A3), partial | CSB-RP049544h

(No reviews yet) Write a Review
SKU:
CSB-RP049544h
Availability:
13 - 23 Working Days
  • Recombinant Human Tricarboxylate transport protein (SLC20A3), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Tricarboxylate transport protein (SLC20A3), partial | CSB-RP049544h | Cusabio

Alternative Name(s): Citrate transport protein ;CTPSolute carrier family 25 member 1Tricarboxylate carrier protein

Gene Names: SLC20A3

Research Areas: Transport

Organism: Homo sapiens (Human)

AA Sequence: EYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGL

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 47-87aa

Sequence Info: Partial

MW: 31.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in citrate-H+/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD+ for the glycolytic pathway.

Reference: Lysine acetylation targets protein complexes and co-regulates major cellular functions.Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.Science 325:834-840(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in citrate-H(+)/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD(+) for the glycolytic pathway.

Involvement in disease: Combined D-2- and L-2-hydroxyglutaric aciduria (D2L2AD)

Subcellular Location: Mitochondrion inner membrane, Multi-pass membrane protein

Protein Families: Mitochondrial carrier (TC 2.A.29) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P53007

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose