Recombinant Human Transmembrane protein 119 (TMEM119), partial | CSB-MP023686HUd9

Recombinant Human Transmembrane protein 119 (TMEM119), partial | CSB-MP023686HUd9 | Cusabio

Alternative Name(s): Osteoblast induction factor (OBIF)

Gene Names: TMEM119

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: RSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQPITLGGPSPPTNFLDGIVDFFRQYVM

Source: Mammalian cell

Tag Info: C-terminal hFc-tagged

Expression Region: 26–96aa

Sequence Info: Partial

MW: 36.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Plays an important role in bone formation and normal bone mineralization. Promotes the differentiation of myoblasts into osteoblasts. May induce the commitment and differentiation of myoblasts into osteoblasts through an enhancement of BMP2 production and interaction with the BMP-RUNX2 pathway. Upregulates the expression of ATF4, a transcription factor which plays a central role in osteoblast differentiation. Essential for normal spermatogenesis and late testicular differentiation.

Reference: "TMEM119 marks a subset of microglia in the human brain." Satoh J.I., Kino Y., Asahina N., Takitani M., Miyoshi J., Ishida T., Saito Y. Neuropathology 36:39-49(2016)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q4V9L6

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A