Recombinant Human Transmembrane protease serine 2 (TMPRSS2) (R255Q), partial (Active) | CSB-MP023924HU (M) b0

Recombinant Human Transmembrane protease serine 2 (TMPRSS2) (R255Q) ,partial (Active) | CSB-MP023924HU (M) b0 | Cusabio

Protein Description: Partial

Alternative Name (s) :

Gene Names: TMPRSS2

Research Areas: Biochemicals

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: N-terminal 10xHis-tagged

Expression Region: 106-492aa (R255Q)

Sequence Info: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSQIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

Biological Activity: ①Recombinant Human TMPRSS2 His tag protein (CSB-MP023924HU (M) b0) enzyme activity is measured by its ability to cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC) , The Km is 19.16μM. ②Measured by Bromhexine Hydrochloride inhibit ratio on TMPRSS2 (CSB-MP023924HU (M) b0) , which can cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC) . The Bromhexine Hydrochloride inhibit EC50 is 81.79-154.2μM. ③Measured by Camostat Mesylate inhibit ratio on TMPRSS2 (CSB-MP023924HU (M) b0) , which can cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC) . The Camostat Mesylate inhibit EC50 is 0.005877- 0.01293μM.

MW: 46.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test.

Relevance:

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O15393

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A