Recombinant Human Translation initiation factor IF-3, mitochondrial (MTIF3) | CSB-EP862000HU

Recombinant Human Translation initiation factor IF-3, mitochondrial (MTIF3) | CSB-EP862000HU | Cusabio

Alternative Name(s): DC38; IF 3 ; IF 3Mt; IF-3(Mt); IF-3Mt; IF3 ; IF3(mt); IF3M_HUMAN; IF3mt; mitochondrial; Mt; MTIF3; Translation initiation factor IF 3; mitochondrial precursor; Translation initiation factor IF-3

Gene Names: MTIF3

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: TAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRAFSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-278aa

Sequence Info: Full Length

MW: 55.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.

Reference: "Mitochondrial translation initiation factor 3 gene polymorphism associated with Parkinson's disease." Abahuni N., Gispert S., Bauer P., Riess O., Kruger R., Becker T., Auburger G. Neurosci. Lett. 414:126-129(2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.

Involvement in disease:

Subcellular Location: Mitochondrion

Protein Families: IF-3 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9H2K0

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A