Recombinant Human Transforming growth factor beta-3 (TGFB3), Partial (Active) | CSB-AP004051HU

(No reviews yet) Write a Review
SKU:
CSB-AP004051HU
Availability:
5 to 10 Working Days
  • Recombinant Human Transforming growth factor beta-3 (TGFB3) ,Partial (Active)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$345.60 - $782.40

Description

Recombinant Human Transforming growth factor beta-3 (TGFB3) ,Partial (Active) | CSB-AP004051HU | Cusabio

Protein Description: Partial

Alternative Name (s) : Transforming growth factor beta-3;TGFB3;TGF-beta-3;Latency-associated peptide;LAP

Gene Names: TGFB3

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: Tag-Free

Expression Region: 301-412aa (Y340F)

Sequence Info: ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS

Biological Activity: The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T cells is less than 2 ng/ml.

MW: 12.7 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Transforming growth factor beta 3 (TGFB3) is a member of a TGF -β superfamily which is defined by theirstructural and functional similarities. TGFB3 is secreted as a complex with LAP. This latent form of TGFB3becomes active upon cleavage by plasmin, matrix metalloproteases, thrombospondin -1, and a subset ofintegrins. It binds with high affinity to TGF- β RII, a type II serine/threonine kinase receptor. TGFB3 is involved incell differentiation, embryogenesis and development.It is believed to regulate molecules involved in cellularadhesion and extracellular matrix (ECM) formation during the process of palate development. Without TGF-β3,mammals develop a deformity known as a cleft palate.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Involved in embryogenesis and cell differentiation.

Involvement in disease: Arrhythmogenic right ventricular dysplasia, familial, 1 (ARVD1) ; Loeys-Dietz syndrome 5 (LDS5)

Subcellular Location: Secreted

Protein Families: TGF-beta family

Tissue Specificity:

Paythway: Hipposignalingpathway

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered solution of 50mM Glycine-HCl, 150mM NaCl, pH2.5.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P10600

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose