Recombinant Human Transforming growth factor beta-2 proprotein (TGFB2), partial (Active) | CSB-AP003961HU

(No reviews yet) Write a Review
SKU:
CSB-AP003961HU
Availability:
5 to 10 Working Days
  • Recombinant Human Transforming growth factor beta-2 proprotein (TGFB2) ,partial (Active)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£230.40 - £521.60

Description

Recombinant Human Transforming growth factor beta-2 proprotein (TGFB2) ,partial (Active) | CSB-AP003961HU | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : Transforming growth factor beta-2;TGFB2;Polyergin;G-TSF;Glioblastoma-derived T-cell suppressor factor;Cetermin;BSC-1 cell growth inhibitor;TGF-beta-2

Gene Names: TGFB2

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: Tag-Free

Expression Region: 303-414aa

Sequence Info: ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Biological Activity: The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T cells is less than 15 ng/ml.

MW: 12.7 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Transforming growth factor beta-2 (TGF-β2) is a secreted protein which belongs to the TGF-beta family. It is known as a cytokine that performs many cellular functions and has a vital role during embryonic development. The precursor is cleaved into mature TGF-beta-2 and LAP, which remains non-covalently linked to mature TGF-beta-2 rendering it inactive. It is an extracellular glycosylated protein. It is known to suppress the effects of interleukin dependent T-cell tumors. Defects in TGFB2 may be a cause of non-syndromic aortic disease (NSAD) .

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: TGF-beta 2 has suppressive effects on interleukin-2 dependent T-cell growth.

Involvement in disease: Loeys-Dietz syndrome 4 (LDS4)

Subcellular Location: Secreted

Protein Families: TGF-beta family

Tissue Specificity:

Paythway: Hipposignalingpathway

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm Filtered 4 mM HCl

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P61812

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose