Recombinant Human Transforming growth factor beta-1 (TGFB1), partial | CSB-EP023446HU1

(No reviews yet) Write a Review
SKU:
CSB-EP023446HU1
Availability:
3 - 7 Working Days
  • Recombinant Human Transforming growth factor beta-1 (TGFB1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Transforming growth factor beta-1 (TGFB1), partial | CSB-EP023446HU1 | Cusabio

Alternative Name(s): Cartilage-inducing factor; CED; Differentiation inhibiting factor; DPD1; LAP; Latency-associated peptide; Prepro transforming growth factor beta 1; TGF beta 1; TGF beta; TGF beta 1 protein; TGF-beta 1 protein; TGF-beta-1; TGF-beta-5; TGF-beta1; TGFB; Tgfb-1; tgfb1; TGFB1_HUMAN; TGFbeta; TGFbeta1; Transforming Growth Factor b1; Transforming Growth Factor beta 1; Transforming growth factor beta 1a; transforming growth factor beta-1; transforming growth factor, beta 1; Transforming Growth Factor-??

Gene Names: TGFB

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 281-390aa

Sequence Info: Partial

MW: 16.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone rodeling as it is a potent stimulator of osteoblastic bone formation, causing chotaxis, proliferation and differentiation in committed osteoblasts. Can promote either T-helper 17 cells (Th17) or regulatory T-cells (Treg) lineage differentiation in a concentration-dependent manner. At high concentrations, leads to FOXP3-mediated suppression of RORC and down-regulation of IL-17 expression, favoring Treg cell development. At low concentrations in concert with IL-6 and IL-21, leads to expression of the IL-17 and IL-23 receptors, favoring differentiation to Th17 cells.

Reference: Intron-exon structure of the human transforming growth factor-beta precursor gene.Derynck R., Rhee L., Chen E.Y., van Tilburg A.Nucleic Acids Res. 15:3188-3189(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts (By similarity). Stimulates sustained production of collagen through the activation of CREB3L1 by regulated intramembrane proteolysis (RIP)

Involvement in disease: Camurati-Engelmann disease (CAEND)

Subcellular Location: Secreted, extracellular space, extracellular matrix

Protein Families: TGF-beta family

Tissue Specificity: Highly expressed in bone. Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA). Colocalizes with ASPN in chondrocytes within OA lesions of articular cartilage.

Paythway: Hipposignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01137

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose