Recombinant Human Transcription factor PU.1 (SPI1) | CSB-EP022567HU

(No reviews yet) Write a Review
SKU:
CSB-EP022567HU
Availability:
3 - 7 Working Days
  • Recombinant Human Transcription factor PU.1 (SPI1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£212.80 - £1,152.00

Description

Recombinant Human Transcription factor PU.1 (SPI1) | CSB-EP022567HU | Cusabio

Alternative Name(s): 31KDA-transforming protein

Gene Names: SPI1

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-270aa

Sequence Info: Full Length

MW: 35.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. This protein is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B-cells. Also binds RNA and may modulate pre-mRNA splicing

Reference: "The human homologue of the putative proto-oncogene Spi-1: characterization and expression in tumors." Ray D., Culine S., Tavitian A., Moreau-Gachelin F. Oncogene 5:663-668(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. This protein is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B-cells. Also binds RNA and may modulate pre-mRNA splicing (By similarity).

Involvement in disease:

Subcellular Location: Nucleus

Protein Families: ETS family

Tissue Specificity:

Paythway: Osteoclastdifferentiation

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P17947

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose