Recombinant Human Trans-1, 2-dihydrobenzene-1, 2-diol dehydrogenase (DHDH) | CSB-EP890780HU

Recombinant Human Trans-1, 2-dihydrobenzene-1, 2-diol dehydrogenase (DHDH) | CSB-EP890780HU | Cusabio

Alternative Name(s): D-xylose 1-dehydrogenase D-xylose-NADP dehydrogenase Dimeric dihydrodiol dehydrogenase Hum2DD

Gene Names: DHDH

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPEKISVVGRRHETGVDDTVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-334aa

Sequence Info: Full Length

MW: 63.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Overexpression of dihydrodiol dehydrogenase as a prognostic marker in resected gastric cancer patients." Chang H.C., Chen Y.L., Chan C.P., Yeh K.T., Kuo S.J., Ko C.J., Fang H.Y. Dig. Dis. Sci. 54:342-347(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families: Gfo/Idh/MocA family

Tissue Specificity: Small intestine.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9UQ10

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM