Cusabio Human Recombinants
Recombinant Human TRAF family member-associated NF-kappa-B activator (TANK), partial | CSB-EP023116HU
- SKU:
- CSB-EP023116HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human TRAF family member-associated NF-kappa-B activator (TANK), partial | CSB-EP023116HU | Cusabio
Alternative Name(s): TRAF-interacting protein ;I-TRAF
Gene Names: TANK
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPR
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-119aa
Sequence Info: Partial
MW: 40.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Adapter protein involved in I-kappa-B-kinase (IKK) regulation which constitutively binds TBK1 and IKBKE playing a role in antiviral innate immunity. Acts as a regulator of TRAF function by maintaining th in a latent state. Blocks TRAF2 binding to LMP1 and inhibits LMP1-mediated NF-kappa-B activation. May control negatively TRAF2-mediated NF-kappa-B activation signaled by CD40, TNFR1 and TNFR2.
Reference: I-TRAF is a novel TRAF-interacting protein that regulates TRAF-mediated signal transduction.Rothe M., Xiong J., Shu H.-B., Williamson K., Goddard A., Goeddel D.V.Proc. Natl. Acad. Sci. U.S.A. 93:8241-8246(1996)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Adapter protein involved in I-kappa-B-kinase (IKK) regulation which constitutively binds TBK1 and IKBKE playing a role in antiviral innate immunity. Acts as a regulator of TRAF function by maintaining them in a latent state. Blocks TRAF2 binding to LMP1 and inhibits LMP1-mediated NF-kappa-B activation. Negatively regulates NF-kappaB signaling and cell survival upon DNA damage
Involvement in disease:
Subcellular Location: Cytoplasm
Protein Families:
Tissue Specificity: Ubiquitous.
Paythway: NOD-likereceptorsignalingpathway
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q92844
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM