Recombinant Human TP53-regulated inhibitor of apoptosis 1 (TRIAP1) | CSB-EP024443HU

Recombinant Human TP53-regulated inhibitor of apoptosis 1 (TRIAP1) | CSB-EP024443HU | Cusabio

Alternative Name(s): Protein 15E1.1 WF-1 p53-inducible cell-survival factor

Gene Names: TRIAP1

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENSS

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-76aa

Sequence Info: Full Length

MW: 35.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Likewise, the TRIAP1:PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo). Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis

Reference: "p53CSV, a novel p53-inducible gene involved in the p53-dependent cell-survival pathway." Park W.-R., Nakamura Y. Cancer Res. 65:1197-1206(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1

Involvement in disease:

Subcellular Location: Cytoplasm, perinuclear region, Mitochondrion, Mitochondrion intermembrane space

Protein Families: TRIAP1/MDM35 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O43715

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM