Recombinant Human TLC domain-containing protein 1 (TLCD1) | CSB-CF822191HU

(No reviews yet) Write a Review
SKU:
CSB-CF822191HU
Availability:
3 - 7 Working Days
$1,604.40 - $2,650.80

Description

Recombinant Human TLC domain-containing protein 1 (TLCD1) | CSB-CF822191HU | Cusabio

Alternative Name(s): TLC domain-containing protein 1(Calfacilitin)

Gene Names: TLCD1

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: RADPLRTWRWHNLLVSFAHSIVSGIWALLCVWQTPDMLVEIETAWSLSGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVMAMGAFFSGIFWSSFVGGGVLTLLVEVSNIFLTIRMMMKISNAQDHLLYRVNKYVNLVMYFLFRLAPQAYLTHFFLRYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFCPEHVPKKQHKDKFLTE

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-tagged

Expression Region: 36-247aa

Sequence Info: Full Length of Mature Protein

MW: 26.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Regulates the composition and fluidity of the plasma membrane (PubMed:30509349). Inhibits the incorporation of membrane-fluidizing phospholipids containing omega-3 long-chain polyunsaturated fatty acids (LCPUFA) and thereby promotes membrane rigidity (PubMed:30509349). Does not appear to have any effect on LCPUFA synthesis (PubMed:30509349).

Reference: "Membrane fluidity is regulated by the C. elegans transmembrane protein FLD-1 and its human homologs TLCD1/2." Ruiz M., Bodhicharla R., Svensk E., Devkota R., Busayavalasa K., Palmgren H., Staahlman M., Boren J., Pilon M. Elife 7:0-0(2018)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q96CP7

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose