Recombinant Human Thymic stromal lymphopoietin (TSLP) | CSB-MP025141HU

(No reviews yet) Write a Review
SKU:
CSB-MP025141HU
Availability:
3 - 7 Working Days
  • Recombinant Human Thymic stromal lymphopoietin (TSLP)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$463.20 - $1,080.00

Description

Recombinant Human Thymic stromal lymphopoietin (TSLP) | CSB-MP025141HU | Cusabio

Alternative Name(s): Thymic stromal lymphopoietin; Thymic stromal lymphopoietin protein TSLP; Tslp; TSLP protein; TSLP_HUMAN

Gene Names: TSLP

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Source: Mammalian cell

Tag Info: N-terminal 6xHis-tagged

Expression Region: 29-159aa

Sequence Info: Full Length of Mature Protein

MW: 18.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Isoform 1: Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c+ dendritic cells. Can induce allergic inflammation by directly activating mast cells. Isoform 2: May act as an antimicrobial peptide in the oral cavity and on the skin.

Reference: "Cloning of human thymic stromal lymphopoietin (TSLP) and signaling mechanisms leading to proliferation."Quentmeier H., Drexler H.G., Fleckenstein D., Zaborski M., Armstrong A., Sims J.E., Lyman S.D.Leukemia 15:1286-1292(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Isoform 1

Involvement in disease:

Subcellular Location: Secreted

Protein Families:

Tissue Specificity: Isoform 1 is expressed in a number of tissues including heart, liver and prostate. Isoform 2 is the predominant form in keratinocytes of oral mucosa, skin and in salivary glands. It is secreted into saliva.

Paythway: Jak-STATsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q969D9

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose