Recombinant Human Thrombopoietin (THPO), partial | CSB-EP023509HU

(No reviews yet) Write a Review
SKU:
CSB-EP023509HU
Availability:
13 - 23 Working Days
  • Recombinant Human Thrombopoietin (THPO), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Thrombopoietin (THPO), partial | CSB-EP023509HU | Cusabio

Alternative Name(s): C-mpl ligand Short name: ML Megakaryocyte colony-stimulating factor Megakaryocyte growth and development factor Short name: MGDF Myeloproliferative leukemia virus oncogene ligand

Gene Names: THPO

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 22-195aa

Sequence Info: Partial

MW: 34.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.

Reference: "Stimulation of megakaryocytopoiesis and thrombopoiesis by the c-Mpl ligand." de Sauvage F.J., Hass P.E., Spencer S.D., Malloy B.E., Gurney A.L., Spencer S.A., Darbonne W.C., Henzel W.J., Wong S.C., Kuang W.-J., Oles K.J., Hultgren B., Solberg L.A. Jr., Goeddel D.V., Eaton D.L. Nature 369:533-538(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.

Involvement in disease: Thrombocythemia 1 (THCYT1)

Subcellular Location: Secreted

Protein Families: EPO/TPO family

Tissue Specificity:

Paythway: Jak-STATsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P40225

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose