Recombinant Human Thioredoxin-like protein 4B (TXNL4B) | CSB-EP868342HU

Recombinant Human Thioredoxin-like protein 4B (TXNL4B) | CSB-EP868342HU | Cusabio

Alternative Name(s): Dim1-like protein

Gene Names: TXNL4B

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-149aa

Sequence Info: Full Length

MW: 44 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G2 transition.

Reference: "DLP, a novel Dim1 family protein implicated in pre-mRNA splicing and cell cycle progression." Sun X., Zhang H., Wang D., Ma D., Shen Y., Shang Y. J. Biol. Chem. 279:32839-32847(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G(2) transition.

Involvement in disease:

Subcellular Location: Nucleus

Protein Families: DIM1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9NX01

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM