Recombinant Human Thioredoxin domain-containing protein 12 (TXNDC12) | CSB-EP025371HU

Recombinant Human Thioredoxin domain-containing protein 12 (TXNDC12) | CSB-EP025371HU | Cusabio

Alternative Name(s): Endoplasmic reticulum resident protein 18 ;ER protein 18 ;ERp18Endoplasmic reticulum resident protein 19 ;ER protein 19 ;ERp19Thioredoxin-like protein p19hTLP19

Gene Names: TXNDC12

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 27-172aa

Sequence Info: Full Length of Mature Protein

MW: 32.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Possesses significant protein thiol-disulfide oxidase activity.

Reference: Solution structure and dynamics of ERp18, a small endoplasmic reticulum resident oxidoreductase.Rowe M.L., Ruddock L.W., Kelly G., Schmidt J.M., Williamson R.A., Howard M.J.Biochemistry 48:4596-4606(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Possesses significant protein thiol-disulfide oxidase activity.

Involvement in disease:

Subcellular Location: Endoplasmic reticulum lumen

Protein Families:

Tissue Specificity: Widely expressed.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O95881

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM