Recombinant Human Tetraspanin-2 (TSPAN2), partial | CSB-YP025157HU1

(No reviews yet) Write a Review
SKU:
CSB-YP025157HU1
Availability:
25 - 35 Working Days
$357.60 - $1,362.00

Description

Recombinant Human Tetraspanin-2 (TSPAN2), partial | CSB-YP025157HU1 | Cusabio

Alternative Name(s): TSPAN2Tetraspanin-2; Tspan-2; Tetraspan NET-3

Gene Names: TSPAN2

Research Areas: Stem Cells

Organism: Homo sapiens (Human)

AA Sequence: GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQL

Source: Yeast

Tag Info: C-terminal 6xHis-tagged

Expression Region: 112-188aa

Sequence Info: Partial

MW: 9.5

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May play a role in signalling in oligodendrocytes in the early stages of their terminal differentiation into myelin-forming glia and may also function in stabilizing the mature sheath.

Reference: "New genetic associations detected in a host response study to hepatitis B vaccine." Davila S., Froeling F.E., Tan A., Bonnard C., Boland G.J., Snippe H., Hibberd M.L., Seielstad M. Genes Immun. 11:232-238(2010)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O60636

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose