Recombinant Human TeRatocarcinoma-derived growth factor 1 (TDGF1), partial | CSB-EP023343HU1

Recombinant Human TeRatocarcinoma-derived growth factor 1 (TDGF1), partial | CSB-EP023343HU1 | Cusabio

Alternative Name(s): Cripto-1 growth factor ;CRGFEpidermal growth factor-like cripto protein CR1

Gene Names: TDGF1

Research Areas: Developmental Biology

Organism: Homo sapiens (Human)

AA Sequence: GHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 32-150aa

Sequence Info: Partial

MW: 17.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.

Reference: Molecular characterization of a gene of the 'EGF family' expressed in undifferentiated human NTERA2 teratocarcinoma cells.Ciccodicola A., Dono R., Obici S., Zollo M., Persico M.G.EMBO J. 8:1987-1991(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: GPI-anchored cell membrane protein involved in Nodal signaling. Cell-associated TDGF1 acts as a Nodal coreceptor in cis. Shedding of TDGF1 by TMEM8A modulates Nodal signaling by allowing soluble TDGF1 to act as a Nodal coreceptor on other cells

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor, Secreted

Protein Families: EGF-CFC (Cripto-1/FRL1/Cryptic) family

Tissue Specificity: Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts. Expressed in breast and lung.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P13385

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM