Recombinant Human Talin-2 (TLN2), partial | CSB-EP897282HU

Recombinant Human Talin-2 (TLN2), partial | CSB-EP897282HU | Cusabio

Alternative Name(s): DKFZp451B1011; DKFZp686I0976; DKFZp686K0979; ILWEQ; KIAA0320; Talin-2; talin2; TLN 2; TLN2; TLN2_HUMAN

Gene Names: TLN2

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: RPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKK

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 88-406aa

Sequence Info: Partial

MW: 53.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: As a major component of focal adhesion plaques that links integrin to the actin cytoskeleton, may play an important role in cell adhesion. Recruits PIP5K1C to focal adhesion plaques and strongly activates its kinase activity .

Reference: Recruitment and regulation of phosphatidylinositol phosphate kinase type 1 gamma by the FERM domain of talin.Di Paolo G., Pellegrini L., Letinic K., Cestra G., Zoncu R., Voronov S., Chang S., Guo J., Wenk M.R., De Camilli P.Nature 420:85-89(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: As a major component of focal adhesion plaques that links integrin to the actin cytoskeleton, may play an important role in cell adhesion. Recruits PIP5K1C to focal adhesion plaques and strongly activates its kinase activity (By similarity).

Involvement in disease:

Subcellular Location: Cytoplasm, Cell junction, focal adhesion, Cell junction, synapse, Cell membrane, Peripheral membrane protein, Cytoplasmic side, Cytoplasm, cytoskeleton

Protein Families:

Tissue Specificity:

Paythway: Focaladhesion

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9Y4G6

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM