Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial | CSB-YP004966HU

(No reviews yet) Write a Review
SKU:
CSB-YP004966HU
Availability:
3 - 7 Working Days
  • Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€262.00 - €943.00

Description

Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial | CSB-YP004966HU | Cusabio

Alternative Name(s): T-lymphocyte differentiation antigen T8/Leu-2 CD_antigen: CD8a

Gene Names: CD8A

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 22-182aa

Sequence Info: Extracellular Domain

MW: 19.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.

Reference: "The isolation and sequence of the gene encoding T8: a molecule defining functional classes of T lymphocytes."Littman D.R., Thomas Y., Maddon P.J., Chess L., Axel R.Cell 40:237-246(1985)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule

Involvement in disease: CD8 deficiency, familial (CD8 deficiency)

Subcellular Location: Isoform 1: Cell membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity: CD8 on thymus-derived T-cells usually consists of a disulfide-linked alpha/CD8A and a beta/CD8B chain. Less frequently, CD8 can be expressed as a CD8A homodimer. A subset of natural killer cells, memory T-cells, intraepithelial lymphocytes, monocytes and dendritic cells expresses CD8A homo-dimers. Expressed at the cell surface of plasmacytoid dendritic cells upon herpes simplex virus-1 stimulation.

Paythway: Antigenprocessingandpresentation

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01732

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose