Recombinant Human T-cell surface glycoprotein CD1c (CD1C), partial | CSB-YP004891HU

Recombinant Human T-cell surface glycoprotein CD1c (CD1C), partial | CSB-YP004891HU | Cusabio

Alternative Name(s): BDCA1; CD1; CD1A; CD1c; CD1c antigen; CD1C antigen c polypeptide; CD1c molecule; CD1C_HUMAN; Cortical thymocyte antigen CD1C; Differentiation antigen CD1 alpha 3; R7; T cell surface glycoprotein CD1c; T-cell surface glycoprotein CD1c

Gene Names: CD1C

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: NADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHFSM

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 18-302aa

Sequence Info: Extracellular Domain

MW: 34.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells.

Reference: "Human CD1b and CD1c isoforms survey different intracellular compartments for the presentation of microbial lipid antigens."Briken V., Jackman R.M., Watts G.F.M., Rogers R.A., Porcelli S.A.J. Exp. Med. 192:281-288(2000) .

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells.

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein, Endosome membrane, Single-pass type I membrane protein, Lysosome

Protein Families:

Tissue Specificity: Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.

Paythway: Hematopoieticcelllineage

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P29017

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM