Recombinant Human T-cell antigen CD7 (CD7), partial | CSB-YP004953HU

(No reviews yet) Write a Review
SKU:
CSB-YP004953HU
Availability:
25 - 35 Working Days
  • Recombinant Human T-cell antigen CD7 (CD7), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$314.40 - $1,687.20

Description

Recombinant Human T-cell antigen CD7 (CD7), partial | CSB-YP004953HU | Cusabio

Alternative Name(s): GP40T-cell leukemia antigen;T-cell surface antigen Leu-9TP41; CD7

Gene Names: CD7

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 26-180aa

Sequence Info: Extracellular Domain

MW: 18.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Not yet known.

Reference: "Identification of CD7 as a cognate of the human K12 (SECTM1) protein."Lyman S.D., Escobar S., Rousseau A.-M., Armstrong A., Fanslow W.C.J. Biol. Chem. 275:3431-3437(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Not yet known.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity:

Paythway: Hematopoieticcelllineage

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P09564

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose