Recombinant Human Store-opeRated calcium entry-associated regulatory factor (SARAF), partial | CSB-YP853392HU

(No reviews yet) Write a Review
SKU:
CSB-YP853392HU
Availability:
25 - 35 Working Days
  • Recombinant Human Store-opeRated calcium entry-associated regulatory factor (SARAF), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$314.40 - $1,131.60

Description

Recombinant Human Store-opeRated calcium entry-associated regulatory factor (SARAF), partial | CSB-YP853392HU | Cusabio

Alternative Name(s): HBV X-transactivated gene 3 protein HBV XAg-transactivated protein 3 Protein FOAP-7 Transmembrane protein 66

Gene Names: SARAF

Research Areas: Biochemicals

Organism: Homo sapiens (Human)

AA Sequence: SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 195-339aa

Sequence Info: Cytoplasmic Domain

MW: 17.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Negative regulator of store-operated Ca2+ entry (SOCE) involved in protecting cells from Ca2+ overfilling. In response to cytosolic Ca2+ elevation after endoplasmic reticulum Ca2+ refilling, promotes a slow inactivation of STIM (STIM1 or STIM2)-dependent SOCE activity: possibly act by facilitating the deoligomerization of STIM to efficiently turn off ORAI when the endoplasmic reticulum lumen is filled with the appropriate Ca2+ levels, and thus preventing the overload of the cell with excessive Ca2+ ions.

Reference: "Molecular cloning of a human novel gene, FOAP-7, which are highly expressed in macrophages."Fujii Y., Tsuritani K., Yajima Y., Amemiya T., Ukai Y., Naito K., Kawaguchi A., Takayama K.Submitted (JUN-1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Negative regulator of store-operated Ca(2+) entry (SOCE) involved in protecting cells from Ca(2+) overfilling. In response to cytosolic Ca(2+) elevation after endoplasmic reticulum Ca(2+) refilling, promotes a slow inactivation of STIM (STIM1 or STIM2)-dependent SOCE activity

Involvement in disease:

Subcellular Location: Endoplasmic reticulum membrane, Single-pass type I membrane protein

Protein Families: SARAF family

Tissue Specificity: Highly expressed in macrophages.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q96BY9

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose