Recombinant Human Statherin (STATH) | CSB-EP022817HU

(No reviews yet) Write a Review
SKU:
CSB-EP022817HU
Availability:
13 - 23 Working Days
  • Recombinant Human Statherin (STATH)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Statherin (STATH) | CSB-EP022817HU | Cusabio

Alternative Name(s): STAT_HUMAN; STATH; Statherin; Statherin precursor ; STR

Gene Names: STATH

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: DSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged

Expression Region: 20-62aa

Sequence Info: Full Length of Mature Protein

MW: 23.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Salivary protein that stabilizes saliva supersaturated with calcium salts by inhibiting the precipitation of calcium phosphate salts. It also modulates hydroxyapatite crystal formation on the tooth surface.

Reference: "Human submandibular gland statherin and basic histidine-rich peptide are encoded by highly abundant mRNA's derived from a common ancestral sequence." Dickinson D.P., Ridall A.L., Levine M.J. Biochem. Biophys. Res. Commun. 149:784-790(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Salivary protein that stabilizes saliva supersaturated with calcium salts by inhibiting the precipitation of calcium phosphate salts. It also modulates hydroxyapatite crystal formation on the tooth surface.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Histatin/statherin family

Tissue Specificity: Secreted by parotid and submandibular glands.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P02808

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose