Cusabio Human Recombinants
Recombinant Human SPARC-related modular calcium-binding protein 1 (SMOC1), Partial | CSB-EP875673HU1
- SKU:
- CSB-EP875673HU1
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human SPARC-related modular calcium-binding protein 1 (SMOC1), Partial | CSB-EP875673HU1 | Cusabio
Alternative Name(s): Secreted modular calcium-binding protein 1
Gene Names: SMOC1
Research Areas: Developmental Biology
Organism: Homo sapiens (Human)
AA Sequence: GRPLPGTSTRYVMPSCESDARAKTTEADDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRFSEPDPSHTLEERVVHWYFSQLDSNSSNDINKR
Source: E.coli
Tag Info: N-terminal 6xHis-GST-tagged
Expression Region: 277-382aa
Sequence Info: Partial
MW: 43.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Plays essential roles in both eye and limb development. Probable regulator of osteoblast differentiation.
Reference: "Secretome analysis of human BMSCs and identification of SMOC1 as an important ECM protein in osteoblast differentiation." Choi Y.A., Lim J., Kim K.M., Acharya B., Cho J.Y., Bae Y.C., Shin H.I., Kim S.Y., Park E.K. J. Proteome Res. 9:2946-2956(2010)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9H4F8
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A