Recombinant Human Solute carrier organic anion transporter family member 2B1 (SLCO2B1), partial | CSB-YP021746HUf3

(No reviews yet) Write a Review
SKU:
CSB-YP021746HUf3
Availability:
25 - 35 Working Days
$459.60 - $1,614.00

Description

Recombinant Human Solute carrier organic anion transporter family member 2B1 (SLCO2B1), partial | CSB-YP021746HUf3 | Cusabio

Alternative Name(s): Organic anion transporter B (OATP-B) (Organic anion transporter polypeptide-related protein 2) (OATP-RP2) (OATPRP2) (Solute carrier family 21 member 9) (KIAA0880) (OATP2B1) (OATPB) (SLC21A9)

Gene Names: SLCO2B1

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: FFIGCSSHQIAGITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPF

Source: Yeast

Tag Info: C-terminal 6xHis-Myc-tagged

Expression Region: 461-564aa

Sequence Info: Partial

MW: 14.7

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Mediates the Na+-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost.

Reference: "Identification and characterization of novel human OATP family members." Wu Y., Hsiang B.H., Zhu Y., Yang W.-P., Kirchgessner T.G. Submitted (NOV-1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O94956

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose